SCOPe 2.06: Domain d5bpma1: 5bpm A:4-188

Lineage for d5bpma1 (5bpm A:4-188)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)

6. Protein automated matches [226905] (13 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225574] (46 PDB entries)

8. Domain d5bpma1: 5bpm A:4-188 [322728]
   automated match to d1hjoa1
   complexed with atp, cl, mg, na; mutant

Details for d5bpma1

PDB Entry: 5bpm, 1.83 Å

PDB Description: crystal structure of unhydrolyzed atp bound human hsp70 nbd double mutant e268q+r272k.

PDB Compounds: (A:) heat shock 70 kda protein 1a

SCOPe Domain Sequences for d5bpma1:

Sequence; same for both SEQRES and ATOM records:

>d5bpma1 c.55.1.1 (A:4-188) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aaaigidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvalnp
qntvfdakrligrkfgdpvvqsdmkhwpfqvindgdkpkvqvsykgetkafypeeissmv
ltkmkeiaeaylgypvtnavitvpayfndsqrqatkdagviaglnvlriineptaaaiay
gldrt

Timeline for d5bpma1:

• d5bpma1 is new in SCOPe 2.06-stable
  
• d5bpma1 appears in SCOPe 2.07
  
• d5bpma1 appears in the current release, SCOPe 2.08