| Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
| Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species) |
| Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries) |
| Domain d1ng1_2: 1ng1 89-294 [32272] Other proteins in same PDB: d1ng1_1 complexed with acy, cd, edo, gdp, mo4, mo6 |
PDB Entry: 1ng1 (more details), 2.03 Å
SCOP Domain Sequences for d1ng1_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ng1_2 c.37.1.10 (89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm
Timeline for d1ng1_2: