Lineage for d1ng1_2 (1ng1 89-294)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393331Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 393332Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 394266Family c.37.1.10: Nitrogenase iron protein-like [52652] (10 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 394367Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 394378Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries)
  8. 394385Domain d1ng1_2: 1ng1 89-294 [32272]
    Other proteins in same PDB: d1ng1_1
    complexed with acy, cd, edo, gdp, mo4, mo6

Details for d1ng1_2

PDB Entry: 1ng1 (more details), 2.03 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d1ng1_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ng1_2 c.37.1.10 (89-294) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgm

SCOP Domain Coordinates for d1ng1_2:

Click to download the PDB-style file with coordinates for d1ng1_2.
(The format of our PDB-style files is described here.)

Timeline for d1ng1_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ng1_1