Lineage for d1ffh_2 (1ffh 89-295)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581392Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 581393Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (23 families) (S)
    division into families based on beta-sheet topologies
  5. 582486Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 582598Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 582609Species Thermus aquaticus [TaxId:271] [52665] (11 PDB entries)
  8. 582615Domain d1ffh_2: 1ffh 89-295 [32271]
    Other proteins in same PDB: d1ffh_1
    complexed with mo5

Details for d1ffh_2

PDB Entry: 1ffh (more details), 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d1ffh_2:

Sequence, based on SEQRES records: (download)

>d1ffh_2 c.37.1.10 (89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Sequence, based on observed residues (ATOM records): (download)

>d1ffh_2 c.37.1.10 (89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
faglepfyperlagrilgmg

SCOP Domain Coordinates for d1ffh_2:

Click to download the PDB-style file with coordinates for d1ffh_2.
(The format of our PDB-style files is described here.)

Timeline for d1ffh_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ffh_1