SCOP 1.55: Domain d1ffh_2: 1ffh 89-295

Lineage for d1ffh_2 (1ffh 89-295)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families)

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (1 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (5 PDB entries)

8. Domain d1ffh_2: 1ffh 89-295 [32271]
   Other proteins in same PDB: d1ffh_1

Details for d1ffh_2

PDB Entry: 1ffh, 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

SCOP Domain Sequences for d1ffh_2:

Sequence, based on SEQRES records:

>d1ffh_2 c.37.1.10 (89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Sequence, based on observed residues (ATOM records):

>d1ffh_2 c.37.1.10 (89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
faglepfyperlagrilgmg

Timeline for d1ffh_2:

• d1ffh_2 appears in SCOP 1.57
  
• d1ffh_2 appears in the current release, SCOPe 2.08, called d1ffha2