Lineage for d1ffha2 (1ffh A:89-295)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869152Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)
  7. 2869164Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries)
  8. 2869178Domain d1ffha2: 1ffh A:89-295 [32271]
    Other proteins in same PDB: d1ffha1
    complexed with mg

Details for d1ffha2

PDB Entry: 1ffh (more details), 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus
PDB Compounds: (A:) ffh

SCOPe Domain Sequences for d1ffha2:

Sequence, based on SEQRES records: (download)

>d1ffha2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Sequence, based on observed residues (ATOM records): (download)

>d1ffha2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
faglepfyperlagrilgmg

SCOPe Domain Coordinates for d1ffha2:

Click to download the PDB-style file with coordinates for d1ffha2.
(The format of our PDB-style files is described here.)

Timeline for d1ffha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ffha1