SCOPe 2.08: Domain d1ffha2: 1ffh A:89-295

Lineage for d1ffha2 (1ffh A:89-295)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein GTPase domain of the signal sequence recognition protein Ffh [52664] (3 species)

7. Species Thermus aquaticus [TaxId:271] [52665] (16 PDB entries)

8. Domain d1ffha2: 1ffh A:89-295 [32271]
   Other proteins in same PDB: d1ffha1
   complexed with mg

Details for d1ffha2

PDB Entry: 1ffh, 2.05 Å

PDB Description: n and gtpase domains of the signal sequence recognition protein ffh from thermus aquaticus

PDB Compounds: (A:) ffh

SCOPe Domain Sequences for d1ffha2:

Sequence, based on SEQRES records:

>d1ffha2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
fagvsekpeglepfyperlagrilgmg

Sequence, based on observed residues (ATOM records):

>d1ffha2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]}
earlpvlkdrnlwflvglqgsgktttaaklalyykgkgrrpllvaadtqrpaareqlrll
gekvgvpvlevmdgespesirrrveekarleardlilvdtagrlqideplmgelarlkev
lgpdevllvldamtgqealsvarafdekvgvtglvltkldgdarggaalsarhvtgkpiy
faglepfyperlagrilgmg

Timeline for d1ffha2:

• d1ffha2 first appeared (with stable ids) in SCOP 1.55, called d1ffh_2
  
• d1ffha2 appears in SCOPe 2.07