Lineage for d5szyc_ (5szy C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944491Species Neisseria meningitidis [TaxId:272831] [193287] (8 PDB entries)
  8. 2944498Domain d5szyc_: 5szy C: [322708]
    automated match to d4iena_
    complexed with cl, coa, gdp

Details for d5szyc_

PDB Entry: 5szy (more details), 2 Å

PDB Description: novel structural insights into gdp-mediated regulation of acyl-coa thioesterases
PDB Compounds: (C:) acyl-CoA hydrolase

SCOPe Domain Sequences for d5szyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5szyc_ d.38.1.0 (C:) automated matches {Neisseria meningitidis [TaxId: 272831]}
rqlpshelimselmmpdtaafsgnvhggellllldqvayscasrysgnycvtlsvdkvlf
kepihigdlvtfyaavnytgrtsmeigirveaqnirtgeirhtnscyftmvavkdgkpvp
vppleiltdrqrcryekakkrrdislqa

SCOPe Domain Coordinates for d5szyc_:

Click to download the PDB-style file with coordinates for d5szyc_.
(The format of our PDB-style files is described here.)

Timeline for d5szyc_: