Lineage for d1cp2b_ (1cp2 B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23485Protein Nitrogenase iron protein [52661] (2 species)
  7. 23513Species Clostridium pasteurianum [TaxId:1501] [52663] (1 PDB entry)
  8. 23515Domain d1cp2b_: 1cp2 B: [32270]

Details for d1cp2b_

PDB Entry: 1cp2 (more details), 1.93 Å

PDB Description: nitrogenase iron protein from clostridium pasteurianum

SCOP Domain Sequences for d1cp2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cp2b_ c.37.1.10 (B:) Nitrogenase iron protein {Clostridium pasteurianum}
mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
arkvdanelfvipkpmtqerleeilmqyg

SCOP Domain Coordinates for d1cp2b_:

Click to download the PDB-style file with coordinates for d1cp2b_.
(The format of our PDB-style files is described here.)

Timeline for d1cp2b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1cp2a_