SCOPe 2.06: Domain d5l79a1: 5l79 A:106-263

Lineage for d5l79a1 (5l79 A:106-263)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (47 PDB entries)

8. Domain d5l79a1: 5l79 A:106-263 [322697]
   Other proteins in same PDB: d5l79a2
   automated match to d4i03a_
   complexed with 6pj, ca, edo, gol, r47, zn

Details for d5l79a1

PDB Entry: 5l79, 2.07 Å

PDB Description: crystal structure of mmp12 in complex with rxp470.1 conjugated with fluorophore cy5,5 in space group p21212.

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d5l79a1:

Sequence; same for both SEQRES and ATOM records:

>d5l79a1 d.92.1.11 (A:106-263) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d5l79a1:

• d5l79a1 is new in SCOPe 2.06-stable
  
• d5l79a1 appears in SCOPe 2.07
  
• d5l79a1 appears in the current release, SCOPe 2.08