SCOPe 2.06: Domain d5kvvb2: 5kvv B:157-329

Lineage for d5kvvb2 (5kvv B:157-329)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (29 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [268877] (2 PDB entries)

8. Domain d5kvvb2: 5kvv B:157-329 [322695]
   Other proteins in same PDB: d5kvva1, d5kvvb1
   automated match to d4tvoa2
   complexed with gol, nai, so4, trs

Details for d5kvvb2

PDB Entry: 5kvv, 2.01 Å

PDB Description: structure of malate dehydrogenase in complex with nadh from mycobacterium tuberculosis

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d5kvvb2:

Sequence; same for both SEQRES and ATOM records:

>d5kvvb2 d.162.1.0 (B:157-329) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
trldhnraisqlaaktgaavtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawi
edefiptvakrgaaiidargassaasaasatidaardwllgtpaddwvsmavvsdgsygv
peglissfpvttkggnwtivsgleidefsrgridkstaeladersavtelgli

Timeline for d5kvvb2:

• d5kvvb2 is new in SCOPe 2.06-stable
  
• d5kvvb2 appears in SCOPe 2.07
  
• d5kvvb2 appears in the current release, SCOPe 2.08