Lineage for d1cp2a_ (1cp2 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) 
Protein Nitrogenase iron protein [52661] (2 species) Species Clostridium pasteurianum [TaxId:1501] [52663] (1 PDB entry) 
Domain d1cp2a_: 1cp2 A: [32269]
Details for d1cp2a_
PDB Entry: 1cp2 (more details), 1.93 Å
PDB Description: nitrogenase iron protein from clostridium pasteurianum
SCOP Domain Sequences for d1cp2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum}
mrqvaiygkggigkstttqnltsglhamgktimvvgcdpkadstrlllgglaqksvldtl
reegedveldsilkegyggircvesggpepgvgcagrgiitsinmleqlgaytddldyvf
ydvlgdvvcggfampiregkaqeiyivasgemmalyaanniskgiqkyaksggvrlggii
cnsrkvaneyelldafakelgsqlihfvprspmvtkaeinkqtvieydptceqaeeyrel
arkvdanelfvipkpmtqerleeilmqyg
SCOP Domain Coordinates for d1cp2a_:
Click to download the PDB-style file with coordinates for d1cp2a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1cp2a_:
- d1cp2a_ appears in SCOP 1.57
- d1cp2a_ appears in the current release, SCOPe 2.08
View in 3D
