Lineage for d5kvva2 (5kvv A:157-329)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2556795Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2556796Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2557402Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 2557403Protein automated matches [226850] (36 species)
    not a true protein
  7. 2557522Species Mycobacterium tuberculosis [TaxId:83332] [268877] (2 PDB entries)
  8. 2557525Domain d5kvva2: 5kvv A:157-329 [322687]
    Other proteins in same PDB: d5kvva1, d5kvvb1
    automated match to d4tvoa2
    complexed with gol, nai, so4, trs

Details for d5kvva2

PDB Entry: 5kvv (more details), 2.01 Å

PDB Description: structure of malate dehydrogenase in complex with nadh from mycobacterium tuberculosis
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d5kvva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kvva2 d.162.1.0 (A:157-329) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
trldhnraisqlaaktgaavtdikkmtiwgnhsatqypdlfhaevagknaaevvndqawi
edefiptvakrgaaiidargassaasaasatidaardwllgtpaddwvsmavvsdgsygv
peglissfpvttkggnwtivsgleidefsrgridkstaeladersavtelgli

SCOPe Domain Coordinates for d5kvva2:

Click to download the PDB-style file with coordinates for d5kvva2.
(The format of our PDB-style files is described here.)

Timeline for d5kvva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5kvva1