Lineage for d5b1ao1 (5b1a O:1-90)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023860Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
    two antiparallel transmembrane helices
  4. 3024004Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families) (S)
  5. 3024005Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)
  6. 3024057Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)
  7. 3024058Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)
  8. 3024068Domain d5b1ao1: 5b1a O:1-90 [322681]
    Other proteins in same PDB: d5b1aa_, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1as_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
    automated match to d1v54b2
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1ao1

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (O:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d5b1ao1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ao1 f.17.2.1 (O:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

SCOPe Domain Coordinates for d5b1ao1:

Click to download the PDB-style file with coordinates for d5b1ao1.
(The format of our PDB-style files is described here.)

Timeline for d5b1ao1: