Lineage for d5b1as_ (5b1a S:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2640990Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2641212Superfamily g.41.5: Rubredoxin-like [57802] (4 families) (S)
  5. 2641384Family g.41.5.3: Cytochrome c oxidase Subunit F [57818] (2 proteins)
    membrane-anchored rubredoxin-like domain
    automatically mapped to Pfam PF01215
  6. 2641385Protein Cytochrome c oxidase Subunit F [57819] (1 species)
  7. 2641386Species Cow (Bos taurus) [TaxId:9913] [57820] (49 PDB entries)
  8. 2641398Domain d5b1as_: 5b1a S: [322679]
    Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1ag_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1at_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
    automated match to d1v54f_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1as_

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (S:) cytochrome c oxidase subunit 5b, mitochondrial

SCOPe Domain Sequences for d5b1as_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1as_ g.41.5.3 (S:) Cytochrome c oxidase Subunit F {Cow (Bos taurus) [TaxId: 9913]}
asgggvptdeeqatglerevmlaarkgqdpynilapkatsgtkedpnlvpsitnkrivgc
iceednstviwfwlhkgeaqrcpscgthyklvphqlah

SCOPe Domain Coordinates for d5b1as_:

Click to download the PDB-style file with coordinates for d5b1as_.
(The format of our PDB-style files is described here.)

Timeline for d5b1as_: