![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
![]() | Superfamily a.128.1: Terpenoid synthases [48576] (6 families) ![]() duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
![]() | Family a.128.1.0: automated matches [196408] (1 protein) not a true family |
![]() | Protein automated matches [196409] (46 species) not a true protein |
![]() | Species Geobacillus stearothermophilus [TaxId:1422] [322626] (1 PDB entry) |
![]() | Domain d5aypb_: 5ayp B: [322675] automated match to d1rtra_ |
PDB Entry: 5ayp (more details), 2.31 Å
SCOPe Domain Sequences for d5aypb_:
Sequence, based on SEQRES records: (download)
>d5aypb_ a.128.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} qlsveqflneqkqavetalsryierlegpaklkkamaysleaggkrirpllllstvralg kdpavglpvacaiemihtyslihddlpsmdnddlrrgkptnhkvfgeamailagdgllty afqliteidderippsvrlrlierlakaagpegmvagqaadmegegktltlseleyihrh ktgkmlqysvhagaliggadarqtreldefaahlglafqirddildiegaeekigkpvgs dqsnnkatypallslagakeklafhieaaqrhlrnadvdgaalayicelvaar
>d5aypb_ a.128.1.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} qlsveqflneqkqavetalsryierlegpaklkkamaysleaggkrirpllllstvralg kdpavglpvacaiemihtyslihddlpsmkptnhkvfgeamailagdglltyafqlitei dderippsvrlrlierlakaagpegmvagqaadmegegktltlseleyihrhktgkmlqy svhagaliggadarqtreldefaahlglafqirddildtypallslagakeklafhieaa qrhlrnadvdgaalayicelvaar
Timeline for d5aypb_: