SCOPe 2.07: Domain d5ixyb1: 5ixy B:1-159

Lineage for d5ixyb1 (5ixy B:1-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Lactate dehydrogenase [51859] (19 species)

7. Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (38 PDB entries)

8. Domain d5ixyb1: 5ixy B:1-159 [322672]
   Other proteins in same PDB: d5ixya2, d5ixyb2, d5ixyc2, d5ixyd2
   automated match to d4jnka1
   complexed with gn2, nad, so4

Details for d5ixyb1

PDB Entry: 5ixy, 3 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4- oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one

PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixyb1:

Sequence; same for both SEQRES and ATOM records:

>d5ixyb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

Timeline for d5ixyb1:

• d5ixyb1 first appeared in SCOPe 2.06
  
• d5ixyb1 appears in the current release, SCOPe 2.08