Lineage for d5ixyb1 (5ixy B:1-159)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2429095Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2429134Protein Lactate dehydrogenase [51859] (19 species)
  7. 2429200Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (21 PDB entries)
  8. 2429266Domain d5ixyb1: 5ixy B:1-159 [322672]
    Other proteins in same PDB: d5ixya2, d5ixyb2, d5ixyc2, d5ixyd2
    automated match to d4jnka1
    complexed with gn2, nad, so4

Details for d5ixyb1

PDB Entry: 5ixy (more details), 3 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4- oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
PDB Compounds: (B:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixyb1 c.2.1.5 (B:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d5ixyb1:

Click to download the PDB-style file with coordinates for d5ixyb1.
(The format of our PDB-style files is described here.)

Timeline for d5ixyb1: