Lineage for d1g21g_ (1g21 G:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122260Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 122360Protein Nitrogenase iron protein [52661] (2 species)
  7. 122361Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 122384Domain d1g21g_: 1g21 G: [32267]
    Other proteins in same PDB: d1g21a_, d1g21b_, d1g21c_, d1g21d_

Details for d1g21g_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein
PDB Compounds: (G:)

SCOP Domain Sequences for d1g21g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21g_ c.37.1.10 (G:) Nitrogenase iron protein {Azotobacter vinelandii}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
larkvvdnkllvipnpitmdeleellme

SCOP Domain Coordinates for d1g21g_:

Click to download the PDB-style file with coordinates for d1g21g_.
(The format of our PDB-style files is described here.)

Timeline for d1g21g_: