Lineage for d5kxdb_ (5kxd B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2390272Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2390273Protein automated matches [190437] (66 species)
    not a true protein
  7. 2391077Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries)
  8. 2391083Domain d5kxdb_: 5kxd B: [322669]
    automated match to d4u36a_
    complexed with 6y2, act, bma, ca, fuc, man, mn, nag, xyp

Details for d5kxdb_

PDB Entry: 5kxd (more details), 1.95 Å

PDB Description: wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 6.5
PDB Compounds: (B:) Wisteria floribunda agglutinin

SCOPe Domain Sequences for d5kxdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kxdb_ b.29.1.0 (B:) automated matches {Wisteria floribunda [TaxId: 3922]}
kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl
vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps

SCOPe Domain Coordinates for d5kxdb_:

Click to download the PDB-style file with coordinates for d5kxdb_.
(The format of our PDB-style files is described here.)

Timeline for d5kxdb_: