Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (66 species) not a true protein |
Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries) |
Domain d5kxdb_: 5kxd B: [322669] automated match to d4u36a_ complexed with 6y2, act, bma, ca, fuc, man, mn, nag, xyp |
PDB Entry: 5kxd (more details), 1.95 Å
SCOPe Domain Sequences for d5kxdb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kxdb_ b.29.1.0 (B:) automated matches {Wisteria floribunda [TaxId: 3922]} kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh ivavefdtfknswdpegthiginvnsivsrktiswdlennevanvvisyqastktltasl vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps
Timeline for d5kxdb_: