![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
![]() | Superfamily a.104.1: Cytochrome P450 [48264] (2 families) ![]() |
![]() | Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
![]() | Protein automated matches [190847] (99 species) not a true protein |
![]() | Species Streptomyces arenae [TaxId:29301] [322659] (9 PDB entries) |
![]() | Domain d5l1pa_: 5l1p A: [322660] automated match to d2xbka_ complexed with 7pt, hem |
PDB Entry: 5l1p (more details), 2.28 Å
SCOPe Domain Sequences for d5l1pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l1pa_ a.104.1.0 (A:) automated matches {Streptomyces arenae [TaxId: 29301]} tdlprlpfdnpdimgiapqmlalqkegpiarvgtagedawlvtrydevrtlladrrlrls npnpqpsaksaarafmvalmagddheteparhaqmrslliprfstrrlrlmktriehhvd elldqlaasappvdlhrvlsfrlptmvvcdllgvpladrerfgqwargtfdqsdnehsan tfqqvvdymlelvarkrvepgddilseliaekdgalsdadiahlgnavllfgyettivri dlgtllllrnpvqraqlaedpglapaaveeilrlgvggkgsnalipryahgditvgetvi rtgdavmlaigaanyddrafpdgglfdltrvrprshlafghgarhcigrtlarieltavf erlfrrlpdlrlavpeeslrwqehritggfdeipvtf
Timeline for d5l1pa_: