Lineage for d1g21f_ (1g21 F:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 179815Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 179924Protein Nitrogenase iron protein [52661] (2 species)
  7. 179925Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 179947Domain d1g21f_: 1g21 F: [32266]
    Other proteins in same PDB: d1g21a_, d1g21b_, d1g21c_, d1g21d_

Details for d1g21f_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein

SCOP Domain Sequences for d1g21f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21f_ c.37.1.10 (F:) Nitrogenase iron protein {Azotobacter vinelandii}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
larkvvdnkllvipnpitmdeleellm

SCOP Domain Coordinates for d1g21f_:

Click to download the PDB-style file with coordinates for d1g21f_.
(The format of our PDB-style files is described here.)

Timeline for d1g21f_: