Lineage for d5khia_ (5khi A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816664Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
    Pfam PF00027
  6. 2816755Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 2816756Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries)
  8. 2816770Domain d5khia_: 5khi A: [322656]
    automated match to d3u10a_
    complexed with 6sx

Details for d5khia_

PDB Entry: 5khi (more details), 2.1 Å

PDB Description: hcn2 cnbd in complex with purine riboside-3', 5'-cyclic monophosphate (cpump)
PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d5khia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5khia_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkknsil

SCOPe Domain Coordinates for d5khia_:

Click to download the PDB-style file with coordinates for d5khia_.
(The format of our PDB-style files is described here.)

Timeline for d5khia_: