Lineage for d5kxcd_ (5kxc D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781436Species Wisteria floribunda [TaxId:3922] [322647] (4 PDB entries)
  8. 2781440Domain d5kxcd_: 5kxc D: [322655]
    automated match to d4u36a_
    complexed with 6y2, ca, mn, nag

Details for d5kxcd_

PDB Entry: 5kxc (more details), 1.8 Å

PDB Description: wisteria floribunda lectin in complex with galnac(beta1-4)glcnac (lacdinac) at ph 8.5.
PDB Compounds: (D:) Wisteria floribunda agglutinin

SCOPe Domain Sequences for d5kxcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kxcd_ b.29.1.0 (D:) automated matches {Wisteria floribunda [TaxId: 3922]}
kettsfvftrfspdpqnlllqgdtvvtssghlqltqvkdgepvysslgralyyapihiwd
sntdtvanfvtsfsfvidapnkakaadglafflapvdtepqkpggllglfhddrhnksnh
ivavefdtfknswdpegthiginvnsivsrktiswdlendevanvvisyqastktltasl
vypssstsyilndvvdlkqilpeyvrvgftaasglskdhvethdvlawtfdsdlpdps

SCOPe Domain Coordinates for d5kxcd_:

Click to download the PDB-style file with coordinates for d5kxcd_.
(The format of our PDB-style files is described here.)

Timeline for d5kxcd_: