Lineage for d1g21e_ (1g21 E:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23485Protein Nitrogenase iron protein [52661] (2 species)
  7. 23486Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 23507Domain d1g21e_: 1g21 E: [32265]
    Other proteins in same PDB: d1g21a_, d1g21b_, d1g21c_, d1g21d_

Details for d1g21e_

PDB Entry: 1g21 (more details), 3 Å

PDB Description: mgatp-bound and nucleotide-free structures of a nitrogenase protein complex between leu127del-fe protein and the mofe protein

SCOP Domain Sequences for d1g21e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g21e_ c.37.1.10 (E:) Nitrogenase iron protein {Azotobacter vinelandii}
mrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimema
aeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddldf
vfydvgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlggl
icnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadeyra
larkvvdnkllvipnpitmdeleellme

SCOP Domain Coordinates for d1g21e_:

Click to download the PDB-style file with coordinates for d1g21e_.
(The format of our PDB-style files is described here.)

Timeline for d1g21e_: