Lineage for d5i98a_ (5i98 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941690Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2941691Protein automated matches [191162] (29 species)
    not a true protein
  7. 2941710Species Candida albicans [TaxId:237561] [322564] (6 PDB entries)
  8. 2941711Domain d5i98a_: 5i98 A: [322649]
    automated match to d4iq2a_

Details for d5i98a_

PDB Entry: 5i98 (more details), 2 Å

PDB Description: structure of apo fkbp12(p104g) from c. albicans
PDB Compounds: (A:) FK506-binding protein 1

SCOPe Domain Sequences for d5i98a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i98a_ d.26.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn

SCOPe Domain Coordinates for d5i98a_:

Click to download the PDB-style file with coordinates for d5i98a_.
(The format of our PDB-style files is described here.)

Timeline for d5i98a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5i98b_