Lineage for d5b1ag_ (5b1a G:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3024907Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family) (S)
    automatically mapped to Pfam PF02046
  5. 3024908Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)
  6. 3024909Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
    probably responsible for the dimerization of the mitochondrial cytochrome c oxidase
  7. 3024910Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)
  8. 3024919Domain d5b1ag_: 5b1a G: [322643]
    Other proteins in same PDB: d5b1aa_, d5b1ab1, d5b1ab2, d5b1ac_, d5b1ad_, d5b1ae_, d5b1af_, d5b1ah_, d5b1ai_, d5b1aj_, d5b1ak_, d5b1al_, d5b1am_, d5b1an_, d5b1ao1, d5b1ao2, d5b1ap_, d5b1aq_, d5b1ar_, d5b1as_, d5b1au_, d5b1av_, d5b1aw_, d5b1ax_, d5b1ay_, d5b1az_
    automated match to d1v54g_
    complexed with cdl, chd, cu, cua, dmu, hea, mg, na, pek, per, pgv, psc, tgl, unx, zn

Details for d5b1ag_

PDB Entry: 5b1a (more details), 1.5 Å

PDB Description: bovine heart cytochrome c oxidase in the fully oxidized state at 1.5 angstrom resolution
PDB Compounds: (G:) Cytochrome c oxidase subunit 6A2, mitochondrial

SCOPe Domain Sequences for d5b1ag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b1ag_ f.23.2.1 (G:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

SCOPe Domain Coordinates for d5b1ag_:

Click to download the PDB-style file with coordinates for d5b1ag_.
(The format of our PDB-style files is described here.)

Timeline for d5b1ag_: