Lineage for d1nipb_ (1nip B:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) 
Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) 
Protein Nitrogenase iron protein [52661] (2 species) 
Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries) 
Domain d1nipb_: 1nip B: [32264]
Details for d1nipb_
PDB Entry: 1nip (more details), 2.9 Å
PDB Description: crystallographic structure of the nitrogenase iron protein from azotobacter vinelandii
SCOP Domain Sequences for d1nipb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nipb_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktae
SCOP Domain Coordinates for d1nipb_:
Click to download the PDB-style file with coordinates for d1nipb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nipb_:
- d1nipb_ appears in SCOP 1.57
- d1nipb_ appears in the current release, SCOPe 2.08
View in 3D
