Lineage for d5khjb_ (5khj B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405483Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2405489Family b.82.3.2: cAMP-binding domain [51210] (13 protein domains)
    Pfam PF00027
  6. 2405578Protein HCN pacemaker channel [101993] (1 species)
    potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
  7. 2405579Species Mouse (Mus musculus) [TaxId:10090] [101994] (10 PDB entries)
  8. 2405591Domain d5khjb_: 5khj B: [322637]
    automated match to d3u10a_
    complexed with 6sy

Details for d5khjb_

PDB Entry: 5khj (more details), 2.01 Å

PDB Description: hcn2 cnbd in complex with uridine-3', 5'-cyclic monophosphate (cump)
PDB Compounds: (B:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d5khjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5khjb_ b.82.3.2 (B:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkknsil

SCOPe Domain Coordinates for d5khjb_:

Click to download the PDB-style file with coordinates for d5khjb_.
(The format of our PDB-style files is described here.)

Timeline for d5khjb_: