Class a: All alpha proteins [46456] (289 folds) |
Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily) common core: 2 helices, disulfide-linked, and a calcium-binding loop |
Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) |
Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins) automatically mapped to Pfam PF00068 |
Protein Phospholipase A2 [48637] (5 species) |
Species Human (Homo sapiens), SPLA2 [TaxId:9606] [74797] (3 PDB entries) group X secretory phospholipase A2 |
Domain d5g3mb_: 5g3m B: [322635] automated match to d1le6a_ complexed with 9jh, ca, dms, peg |
PDB Entry: 5g3m (more details), 1.85 Å
SCOPe Domain Sequences for d5g3mb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g3mb_ a.133.1.2 (B:) Phospholipase A2 {Human (Homo sapiens), SPLA2 [TaxId: 9606]} gilelagtvgcvgprtpiaymkygcfcglgghgqprdaidwcchghdccytraeeagcsp kteryswqcvnqsvlcgpaenkcqellckcdqeianclaqteynlkylfypqflcepdsp kcd
Timeline for d5g3mb_: