SCOPe 2.06: Domain d5khka_: 5khk A:

Lineage for d5khka_ (5khk A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187178] (8 PDB entries)

8. Domain d5khka_: 5khk A: [322634]
   automated match to d3u10a_
   complexed with 6sz

Details for d5khka_

PDB Entry: 5khk, 2.07 Å

PDB Description: hcn2 cnbd in complex with 2-aminopurine riboside-3', 5'-cyclic monophosphate (2-nh2-cpump)

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2

SCOPe Domain Sequences for d5khka_:

Sequence; same for both SEQRES and ATOM records:

>d5khka_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadfrqkihdyyehryqgkmfdedsilgelngplree
ivnfncrklvasmplfanadpnfvtamltklkfevfqpgdyiiregtigkkmyfiqhgvv
svltkgnkemklsdgsyfgeiclltrgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkknsil

Timeline for d5khka_:

• d5khka_ is new in SCOPe 2.06-stable
  
• d5khka_ appears in SCOPe 2.07
  
• d5khka_ appears in the current release, SCOPe 2.08