SCOPe 2.06: Domain d5iltl1: 5ilt L:3-107

Lineage for d5iltl1 (5ilt L:3-107)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226022] (8 PDB entries)

8. Domain d5iltl1: 5ilt L:3-107 [322629]
   automated match to d4k3el1

Details for d5iltl1

PDB Entry: 5ilt, 2 Å

PDB Description: crystal structure of bovine fab a01

PDB Compounds: (L:) bovine Fab A01 light chain

SCOPe Domain Sequences for d5iltl1:

Sequence; same for both SEQRES and ATOM records:

>d5iltl1 b.1.1.0 (L:3-107) automated matches {Cow (Bos taurus) [TaxId: 9913]}
vlnqpssvsgslgqrvsitcsgsssnvgngyvswyqlipgsaprtliygdtsrasgvpdr
fsgsrsgntatltisslqaedeadyfcasaedsssnavfgsgttltvlg

Timeline for d5iltl1:

• d5iltl1 is new in SCOPe 2.06-stable
  
• d5iltl1 appears in SCOPe 2.07
  
• d5iltl1 appears in the current release, SCOPe 2.08