Lineage for d5jh5b2 (5jh5 B:77-159)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2735465Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
    multihelical; interlocked heterodimer with F-box proteins
  4. 2735466Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) (S)
    automatically mapped to Pfam PF01466
  5. 2735467Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)
  6. 2735494Protein automated matches [226933] (1 species)
    not a true protein
  7. 2735495Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)
  8. 2735501Domain d5jh5b2: 5jh5 B:77-159 [322625]
    Other proteins in same PDB: d5jh5b1
    automated match to d3wsob2

Details for d5jh5b2

PDB Entry: 5jh5 (more details), 2.55 Å

PDB Description: structural basis for the hierarchical assembly of the core of prc1.1
PDB Compounds: (B:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d5jh5b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5jh5b2 a.157.1.1 (B:77-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeir
ktfnikndfteeeeaqvrkenqw

SCOPe Domain Coordinates for d5jh5b2:

Click to download the PDB-style file with coordinates for d5jh5b2.
(The format of our PDB-style files is described here.)

Timeline for d5jh5b2: