| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily) multihelical; interlocked heterodimer with F-box proteins |
Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families) ![]() automatically mapped to Pfam PF01466 |
| Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins) |
| Protein automated matches [226933] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries) |
| Domain d5jh5b2: 5jh5 B:77-159 [322625] Other proteins in same PDB: d5jh5b1 automated match to d3wsob2 |
PDB Entry: 5jh5 (more details), 2.55 Å
SCOPe Domain Sequences for d5jh5b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jh5b2 a.157.1.1 (B:77-159) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nkekrtddipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeir
ktfnikndfteeeeaqvrkenqw
Timeline for d5jh5b2: