Lineage for d5ixya2 (5ixy A:160-331)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2604672Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2604673Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2604674Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2604681Protein Lactate dehydrogenase [56339] (20 species)
  7. 2604752Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (38 PDB entries)
  8. 2604931Domain d5ixya2: 5ixy A:160-331 [322621]
    Other proteins in same PDB: d5ixya1, d5ixyb1, d5ixyc1, d5ixyd1
    automated match to d4jnka2
    complexed with gn2, nad, so4

Details for d5ixya2

PDB Entry: 5ixy (more details), 3 Å

PDB Description: lactate dehydrogenase in complex with hydroxylactam inhibitor compound 31: (2~{s})-5-(2-chlorophenyl)sulfanyl-2-(4-morpholin-4-ylphenyl)-4- oxidanyl-2-thiophen-3-yl-1,3-dihydropyridin-6-one
PDB Compounds: (A:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d5ixya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ixya2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]}
sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt
dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl
ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf

SCOPe Domain Coordinates for d5ixya2:

Click to download the PDB-style file with coordinates for d5ixya2.
(The format of our PDB-style files is described here.)

Timeline for d5ixya2: