Lineage for d1n2ch_ (1n2c H:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242911Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 242912Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) (S)
    division into families based on beta-sheet topologies
  5. 243628Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 243741Protein Nitrogenase iron protein [52661] (2 species)
  7. 243742Species Azotobacter vinelandii [TaxId:354] [52662] (11 PDB entries)
  8. 243770Domain d1n2ch_: 1n2c H: [32262]
    Other proteins in same PDB: d1n2ca_, d1n2cb_, d1n2cc_, d1n2cd_
    complexed with adp, alf, ca, cfm, clf, fs4, hca, mg

Details for d1n2ch_

PDB Entry: 1n2c (more details), 3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate

SCOP Domain Sequences for d1n2ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ch_ c.37.1.10 (H:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

SCOP Domain Coordinates for d1n2ch_:

Click to download the PDB-style file with coordinates for d1n2ch_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ch_: