Lineage for d1n2ch_ (1n2c H:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122260Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 122360Protein Nitrogenase iron protein [52661] (2 species)
  7. 122361Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 122381Domain d1n2ch_: 1n2c H: [32262]
    Other proteins in same PDB: d1n2ca_, d1n2cb_, d1n2cc_, d1n2cd_

Details for d1n2ch_

PDB Entry: 1n2c (more details), 3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp-tetrafluoroaluminate
PDB Compounds: (H:)

SCOP Domain Sequences for d1n2ch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2ch_ c.37.1.10 (H:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

SCOP Domain Coordinates for d1n2ch_:

Click to download the PDB-style file with coordinates for d1n2ch_.
(The format of our PDB-style files is described here.)

Timeline for d1n2ch_: