Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily) unusual fold, defines family |
Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) |
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins) N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain) automatically mapped to Pfam PF02866 |
Protein Lactate dehydrogenase [56339] (19 species) |
Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [64445] (16 PDB entries) |
Domain d5ixsc2: 5ixs C:160-331 [322613] Other proteins in same PDB: d5ixsa1, d5ixsb1, d5ixsc1, d5ixsd1 automated match to d1i10d2 complexed with 6ey, epe, nai, so4, txd |
PDB Entry: 5ixs (more details), 2.05 Å
SCOPe Domain Sequences for d5ixsc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ixsc2 d.162.1.1 (C:160-331) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} sgcnldsarfrylmgerlgvhplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgt dkdkeqwkevhkqvvesayeviklkgytswaiglsvadlaesimknlrrvhpvstmikgl ygikddvflsvpcilgqngisdlvkvtltseeearlkksadtlwgiqkelqf
Timeline for d5ixsc2: