![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
![]() | Protein automated matches [191162] (29 species) not a true protein |
![]() | Species Candida albicans [TaxId:237561] [322564] (6 PDB entries) |
![]() | Domain d5hw8e_: 5hw8 E: [322611] automated match to d4iq2a_ complexed with fk5 |
PDB Entry: 5hw8 (more details), 2.86 Å
SCOPe Domain Sequences for d5hw8e_:
Sequence, based on SEQRES records: (download)
>d5hw8e_ d.26.1.0 (E:) automated matches {Candida albicans [TaxId: 237561]} elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw disltnnygkgganlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn
>d5hw8e_ d.26.1.0 (E:) automated matches {Candida albicans [TaxId: 237561]} elpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikgw disltnnygkggnlpkiskgtkailtippnlaygprgipgiigpnetlvfevellgvn
Timeline for d5hw8e_: