Lineage for d1n2cg_ (1n2c G:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1164938Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1165138Protein Nitrogenase iron protein [52661] (2 species)
  7. 1165139Species Azotobacter vinelandii [TaxId:354] [52662] (19 PDB entries)
  8. 1165176Domain d1n2cg_: 1n2c G: [32261]
    Other proteins in same PDB: d1n2ca_, d1n2cb_, d1n2cc_, d1n2cd_
    complexed with adp, alf, ca, cfm, clf, hca, mg, sf4

Details for d1n2cg_

PDB Entry: 1n2c (more details), 3 Å

PDB Description: nitrogenase complex from azotobacter vinelandii stabilized by adp- tetrafluoroaluminate
PDB Compounds: (G:) nitrogenase iron protein

SCOPe Domain Sequences for d1n2cg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1n2cg_ c.37.1.10 (G:) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgim

SCOPe Domain Coordinates for d1n2cg_:

Click to download the PDB-style file with coordinates for d1n2cg_.
(The format of our PDB-style files is described here.)

Timeline for d1n2cg_: