| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
| Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
| Protein automated matches [191162] (27 species) not a true protein |
| Species Candida albicans [TaxId:237561] [322564] (5 PDB entries) |
| Domain d5hw7a_: 5hw7 A: [322595] automated match to d4iq2a_ |
PDB Entry: 5hw7 (more details), 2.29 Å
SCOPe Domain Sequences for d5hw7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hw7a_ d.26.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn
gq
Timeline for d5hw7a_: