SCOPe 2.07: Domain d5hw6b_: 5hw6 B:

Lineage for d5hw6b_ (5hw6 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Candida albicans [TaxId:237561] [322564] (6 PDB entries)

8. Domain d5hw6b_: 5hw6 B: [322588]
   automated match to d4iq2a_
   complexed with act

Details for d5hw6b_

PDB Entry: 5hw6, 2.4 Å

PDB Description: candida albicans fkbp12 apo protein in c2 space group

PDB Compounds: (B:) FK506-binding protein 1

SCOPe Domain Sequences for d5hw6b_:

Sequence, based on SEQRES records:

>d5hw6b_ d.26.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

Sequence, based on observed residues (ATOM records):

>d5hw6b_ d.26.1.0 (B:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefgkpftctvgvgqvikgwdislt
nnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

Timeline for d5hw6b_:

• d5hw6b_ first appeared in SCOPe 2.06
  
• d5hw6b_ appears in the current release, SCOPe 2.08