![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains) |
![]() | Protein Lactate dehydrogenase [51859] (19 species) |
![]() | Species Human (Homo sapiens), muscle isoform (M chain) [TaxId:9606] [63940] (21 PDB entries) |
![]() | Domain d5ixsd1: 5ixs D:1-159 [322586] Other proteins in same PDB: d5ixsa2, d5ixsb2, d5ixsc2, d5ixsd2 automated match to d1i10d1 complexed with 6ey, epe, nai, so4, txd |
PDB Entry: 5ixs (more details), 2.05 Å
SCOPe Domain Sequences for d5ixsd1:
Sequence, based on SEQRES records: (download)
>d5ixsd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii pnvvkyspnckllivsnpvdiltyvawkisgfpknrvig
>d5ixsd1 c.2.1.5 (D:1-159) Lactate dehydrogenase {Human (Homo sapiens), muscle isoform (M chain) [TaxId: 9606]} atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge mmdlqhgslflrtpkivsgkdynvtansklviitagarqqgesrlnlvqrnvnifkfiip nvvkyspnckllivsnpvdiltyvawkisgfpknrvig
Timeline for d5ixsd1: