SCOPe 2.08: Domain d5hwca1: 5hwc A:1-112

Lineage for d5hwca1 (5hwc A:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Neosartorya fumigata [TaxId:330879] [322576] (4 PDB entries)

8. Domain d5hwca1: 5hwc A:1-112 [322577]
   Other proteins in same PDB: d5hwca2
   automated match to d5b8ic_
   complexed with fk5

Details for d5hwca1

PDB Entry: 5hwc, 2.05 Å

PDB Description: aspergillus fumigatus fkbp12 p90g protein bound with fk506 in p212121 space group

PDB Compounds: (A:) FK506-binding protein 1A

SCOPe Domain Sequences for d5hwca1:

Sequence; same for both SEQRES and ATOM records:

>d5hwca1 d.26.1.0 (A:1-112) automated matches {Neosartorya fumigata [TaxId: 330879]}
mgvtkelkspgngvdfpkkgdfvtihytgrltdgskfdssvdrnepfqtqigtgrvikgw
degvpqmslgekavltitpdygygargfpgvipgnstlifevellginnkra

Timeline for d5hwca1:

• d5hwca1 first appeared in SCOPe 2.06
  
• d5hwca1 appears in SCOPe 2.07