SCOPe 2.06: Domain d5g3nb1: 5g3n B:1-124

Lineage for d5g3nb1 (5g3n B:1-124)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
   common core: 2 helices, disulfide-linked, and a calcium-binding loop

4. Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families)

5. Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
   automatically mapped to Pfam PF00068

6. Protein automated matches [190139] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [260458] (2 PDB entries)

8. Domain d5g3nb1: 5g3n B:1-124 [322574]
   Other proteins in same PDB: d5g3na2, d5g3nb2
   automated match to d1n29a_
   complexed with ca, fmt, x28

Details for d5g3nb1

PDB Entry: 5g3n, 1.8 Å

PDB Description: discovery of a novel secreted phospholipase a2 (spla2) inhibitor.

PDB Compounds: (B:) Phospholipase A2, membrane associated

SCOPe Domain Sequences for d5g3nb1:

Sequence; same for both SEQRES and ATOM records:

>d5g3nb1 a.133.1.2 (B:1-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg
tkflsykfsnsgsriscakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

Timeline for d5g3nb1:

• d5g3nb1 is new in SCOPe 2.06-stable
  
• d5g3nb1 appears in SCOPe 2.07
  
• d5g3nb1 appears in the current release, SCOPe 2.08