Lineage for d5g3nb1 (5g3n B:1-124)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732915Fold a.133: Phospholipase A2, PLA2 [48618] (1 superfamily)
    common core: 2 helices, disulfide-linked, and a calcium-binding loop
  4. 2732916Superfamily a.133.1: Phospholipase A2, PLA2 [48619] (4 families) (S)
  5. 2732921Family a.133.1.2: Vertebrate phospholipase A2 [48623] (3 proteins)
    automatically mapped to Pfam PF00068
  6. 2733305Protein automated matches [190139] (27 species)
    not a true protein
  7. 2733424Species Human (Homo sapiens) [TaxId:9606] [260458] (12 PDB entries)
  8. 2733428Domain d5g3nb1: 5g3n B:1-124 [322574]
    Other proteins in same PDB: d5g3na2, d5g3nb2
    automated match to d1n29a_
    complexed with ca, fmt, x28

Details for d5g3nb1

PDB Entry: 5g3n (more details), 1.8 Å

PDB Description: discovery of a novel secreted phospholipase a2 (spla2) inhibitor.
PDB Compounds: (B:) Phospholipase A2, membrane associated

SCOPe Domain Sequences for d5g3nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5g3nb1 a.133.1.2 (B:1-124) automated matches {Human (Homo sapiens) [TaxId: 9606]}
alvnfhrmiklttgkeaalsygfygchcgvggrgspkdatdrccvthdccykrlekrgcg
tkflsykfsnsgsriscakqdscrsqlcecdkaaatcfarnkttynkkyqyysnkhcrgs
tprc

SCOPe Domain Coordinates for d5g3nb1:

Click to download the PDB-style file with coordinates for d5g3nb1.
(The format of our PDB-style files is described here.)

Timeline for d5g3nb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5g3nb2