Lineage for d5hw6a_ (5hw6 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2185705Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2186026Family d.26.1.0: automated matches [191631] (1 protein)
    not a true family
  6. 2186027Protein automated matches [191162] (27 species)
    not a true protein
  7. 2186043Species Candida albicans [TaxId:237561] [322564] (5 PDB entries)
  8. 2186048Domain d5hw6a_: 5hw6 A: [322573]
    automated match to d4iq2a_
    complexed with act

Details for d5hw6a_

PDB Entry: 5hw6 (more details), 2.4 Å

PDB Description: candida albicans fkbp12 apo protein in c2 space group
PDB Compounds: (A:) FK506-binding protein 1

SCOPe Domain Sequences for d5hw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hw6a_ d.26.1.0 (A:) automated matches {Candida albicans [TaxId: 237561]}
eelpqieivqegdnttfakpgdtvtihydgkltngkefdssrkrgkpftctvgvgqvikg
wdisltnnygkgganlpkiskgtkailtippnlaygprgippiigpnetlvfevellgvn

SCOPe Domain Coordinates for d5hw6a_:

Click to download the PDB-style file with coordinates for d5hw6a_.
(The format of our PDB-style files is described here.)

Timeline for d5hw6a_: