Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.0: automated matches [195425] (1 protein) not a true family |
Protein automated matches [195426] (7 species) not a true protein |
Species Staphylococcus aureus [TaxId:282459] [322571] (1 PDB entry) |
Domain d5d1zi_: 5d1z I: [322572] Other proteins in same PDB: d5d1za1, d5d1za2, d5d1zc1, d5d1zc2, d5d1ze1, d5d1ze2, d5d1zh1, d5d1zh2 automated match to d2moqa_ |
PDB Entry: 5d1z (more details), 3.17 Å
SCOPe Domain Sequences for d5d1zi_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d1zi_ b.1.28.0 (I:) automated matches {Staphylococcus aureus [TaxId: 282459]} nntypilnqelreaiknpaikdkdhsapnsrpidfemkkkdgtqqfyhyassvkparvif tdskpeielglqsgqfwrkfevyegdkklpiklvsydtvkdyayirfsvsngtkavkivs sthfnnkeekydytlmefaqpiynsadkf
Timeline for d5d1zi_: