Lineage for d5d1zi_ (5d1z I:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766841Family b.1.28.0: automated matches [195425] (1 protein)
    not a true family
  6. 2766842Protein automated matches [195426] (7 species)
    not a true protein
  7. 2766887Species Staphylococcus aureus [TaxId:282459] [322571] (1 PDB entry)
  8. 2766888Domain d5d1zi_: 5d1z I: [322572]
    Other proteins in same PDB: d5d1za1, d5d1za2, d5d1zc1, d5d1zc2, d5d1ze1, d5d1ze2, d5d1zh1, d5d1zh2
    automated match to d2moqa_

Details for d5d1zi_

PDB Entry: 5d1z (more details), 3.17 Å

PDB Description: isdb neat1 bound by clone d4-10
PDB Compounds: (I:) Iron-regulated surface determinant protein B

SCOPe Domain Sequences for d5d1zi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d1zi_ b.1.28.0 (I:) automated matches {Staphylococcus aureus [TaxId: 282459]}
nntypilnqelreaiknpaikdkdhsapnsrpidfemkkkdgtqqfyhyassvkparvif
tdskpeielglqsgqfwrkfevyegdkklpiklvsydtvkdyayirfsvsngtkavkivs
sthfnnkeekydytlmefaqpiynsadkf

SCOPe Domain Coordinates for d5d1zi_:

Click to download the PDB-style file with coordinates for d5d1zi_.
(The format of our PDB-style files is described here.)

Timeline for d5d1zi_: