Lineage for d1g1ma_ (1g1m A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23485Protein Nitrogenase iron protein [52661] (2 species)
  7. 23486Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries)
  8. 23501Domain d1g1ma_: 1g1m A: [32257]

Details for d1g1ma_

PDB Entry: 1g1m (more details), 2.25 Å

PDB Description: all-ferrous nitrogenase iron protein from azotobacter vinelandii

SCOP Domain Sequences for d1g1ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g1ma_ c.37.1.10 (A:) Nitrogenase iron protein {Azotobacter vinelandii}
amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktae

SCOP Domain Coordinates for d1g1ma_:

Click to download the PDB-style file with coordinates for d1g1ma_.
(The format of our PDB-style files is described here.)

Timeline for d1g1ma_: