Class b: All beta proteins [48724] (178 folds) |
Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.1: Bacterial AB5 toxins, B-subunits [50204] (7 proteins) |
Protein automated matches [190381] (11 species) not a true protein |
Species Escherichia coli [TaxId:634468] [322555] (1 PDB entry) |
Domain d5g3ld_: 5g3l D: [322567] Other proteins in same PDB: d5g3lf_, d5g3lg_ automated match to d1qb5d_ complexed with na, sia |
PDB Entry: 5g3l (more details), 1.72 Å
SCOPe Domain Sequences for d5g3ld_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5g3ld_ b.40.2.1 (D:) automated matches {Escherichia coli [TaxId: 634468]} gasqffkdncnrttaslvegveltkyisdinnntdgmyvvsstggvwrisrakdypdnvm taemrkiaxaavlsgmrvnmcaspasspnviwaieleae
Timeline for d5g3ld_:
View in 3D Domains from other chains: (mouse over for more information) d5g3le_, d5g3lf_, d5g3lg_, d5g3lh_ |