SCOPe 2.08: Domain d5edxb_: 5edx B:

Lineage for d5edxb_ (5edx B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Pig (Sus scrofa) [TaxId:9823] [322548] (1 PDB entry)

8. Domain d5edxb_: 5edx B: [322566]
   automated match to d1akjd_

Details for d5edxb_

PDB Entry: 5edx, 1.8 Å

PDB Description: crystal structure of swine cd8aa homodimer

PDB Compounds: (B:) CD8 alpha antigen

SCOPe Domain Sequences for d5edxb_:

Sequence; same for both SEQRES and ATOM records:

>d5edxb_ b.1.1.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
slfrtspemvqaslgetvklrcevmhsntltscswlyqkpgaaskpiflmylsktrnkta
egldtryisgykandnfylilhrfreedqgyyfcsflsnsvlyfsnfmsvflpa

Timeline for d5edxb_:

• d5edxb_ first appeared in SCOPe 2.06
  
• d5edxb_ appears in SCOPe 2.07