| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
| Protein automated matches [190119] (24 species) not a true protein |
| Species Pig (Sus scrofa) [TaxId:9823] [322548] (1 PDB entry) |
| Domain d5edxb_: 5edx B: [322566] automated match to d1akjd_ |
PDB Entry: 5edx (more details), 1.8 Å
SCOPe Domain Sequences for d5edxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5edxb_ b.1.1.1 (B:) automated matches {Pig (Sus scrofa) [TaxId: 9823]}
slfrtspemvqaslgetvklrcevmhsntltscswlyqkpgaaskpiflmylsktrnkta
egldtryisgykandnfylilhrfreedqgyyfcsflsnsvlyfsnfmsvflpa
Timeline for d5edxb_: