![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) ![]() |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins) |
![]() | Protein Nitrogenase iron protein [52661] (2 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [52662] (9 PDB entries) |
![]() | Domain d1de0b_: 1de0 B: [32256] |
PDB Entry: 1de0 (more details), 2.4 Å
SCOP Domain Sequences for d1de0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1de0b_ c.37.1.10 (B:) Nitrogenase iron protein {Azotobacter vinelandii} amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld fvfydvlgdvvcggwampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
Timeline for d1de0b_: